PDB entry 5x4p

View 5x4p on RCSB PDB site
Description: Crystal structure of the BCL6 BTB domain in complex with Compound 6
Class: Transcription/Inhibitor
Keywords: Transcription Repressor, Transcription-Inhibitor complex
Deposited on 2017-02-13, released 2017-05-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-cell lymphoma 6 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL6, BCL5, LAZ3, ZBTB27, ZNF51
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41182 (16-140)
      • expression tag (11-15)
    Domains in SCOPe 2.08: d5x4pa1, d5x4pa2
  • Heterogens: 7ZO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5x4pA (A:)
    ldykddddkenlyfqgadsciqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahkt
    vlmacsglfysiftdqlkcnlsvinldpeinpegfcilldfmytsrlnlregnimavmat
    amylqmehvvdtcrkfikase
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x4pA (A:)
    lyfqgadsciqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfys
    iftdqlkcnlsvinldpeinpegfcilldfmytsrlnlregnimavmatamylqmehvvd
    tcrkfikase