PDB entry 5x32

View 5x32 on RCSB PDB site
Description: Crystal structure of D-mannose isomerase
Class: isomerase
Keywords: Isomerase
Deposited on 2017-02-03, released 2018-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acylglucosamine 2-epimerase
    Species: Marinomonas mediterranea (strain ATCC 700492 / JCM 21426 / NBRC 103028 / MMB-1) [TaxId:717774]
    Gene: Marme_2490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5x32a_
  • Chain 'B':
    Compound: N-acylglucosamine 2-epimerase
    Species: Marinomonas mediterranea (strain ATCC 700492 / JCM 21426 / NBRC 103028 / MMB-1) [TaxId:717774]
    Gene: Marme_2490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5x32b_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5x32A (A:)
    msypafdsktfleahiektmafyfptcidpeggffqffkddgsvydpntrhlvsstrfif
    nfaqaylhtniaeykhaavhgiqylrqrhqsqsggyvwlldggtnldetnhcyglafvil
    aysnalqiglseaevwievtydllethfwenkhglyldeissdwktvspyrgqnanmhmc
    ealmsafdatqnpkyldrakllaknicqkqaslsnsnevwehytndwqidwdynkndpkh
    lfrpwgfqpghqtewaklllmldkrspenwylpkakylfdlaykkawdtkkgglhygyap
    dgtvcdpdkyfwvqaesfaaawllykatkdetyykqyltlwefswnhmidhtfgawyril
    dennaqydnnkspagktdyhtmgacyevlktltl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x32A (A:)
    msypafdsktfleahiektmafyfptcidpeggffqffkddgsvydpntrhlvsstrfif
    nfaqaylhtniaeykhaavhgiqylrqrhqsqsggyvwlldggtnldetnhcyglafvil
    aysnalqiglseaevwievtydllethfwenkhglyldeissdwktvspyrgqnanmhmc
    ealmsafdatqnpkyldrakllaknicqkqaslsnsnevwehytndwqidwpwgfqpghq
    tewaklllmldkrspenwylpkakylfdlaykkawdtkkgglhygyapdgtvcdpdkyfw
    vqaesfaaawllykatkdetyykqyltlwefswnhmidhtfgawyrildennaqydnnks
    pagktdyhtmgacyevlktl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5x32B (B:)
    msypafdsktfleahiektmafyfptcidpeggffqffkddgsvydpntrhlvsstrfif
    nfaqaylhtniaeykhaavhgiqylrqrhqsqsggyvwlldggtnldetnhcyglafvil
    aysnalqiglseaevwievtydllethfwenkhglyldeissdwktvspyrgqnanmhmc
    ealmsafdatqnpkyldrakllaknicqkqaslsnsnevwehytndwqidwdynkndpkh
    lfrpwgfqpghqtewaklllmldkrspenwylpkakylfdlaykkawdtkkgglhygyap
    dgtvcdpdkyfwvqaesfaaawllykatkdetyykqyltlwefswnhmidhtfgawyril
    dennaqydnnkspagktdyhtmgacyevlktltl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x32B (B:)
    sypafdsktfleahiektmafyfptcidpeggffqffkddgsvydpntrhlvsstrfifn
    faqaylhtniaeykhaavhgiqylrqrhqsqsggyvwlldggtnldetnhcyglafvila
    ysnalqiglseaevwievtydllethfwenkhglyldeissdwktvspyrgqnanmhmce
    almsafdatqnpkyldrakllaknicqkqaslsnsnevwehytndwqidwdynkndpkhl
    frpwgfqpghqtewaklllmldkrspenwylpkakylfdlaykkawdtkkgglhygyapd
    gtvcdpdkyfwvqaesfaaawllykatkdetyykqyltlwefswnhmidhtfgawyrild
    ennaqydnnkspagktdyhtmgacyevlktl