PDB entry 5x2j

View 5x2j on RCSB PDB site
Description: Crystal structure of a recombinant hybrid manganese superoxide dismutase from Staphylococcus equorum and Staphylococcus saprophyticus
Class: oxidoreductase
Keywords: superoxide dismutase, hybrid protein, Staphylococcus equorum, Staphylococcus saprophyticus, OXIDOREDUCTASE
Deposited on 2017-01-31, released 2018-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: manganese superoxide dismutase
  Species: Staphylococcus equorum [TaxId:246432]
  Gene: AST02_02815
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A1E5TT85 (0-198)
    • engineered mutation (12)
  Domains in SCOPe 2.08: d5x2ja1, d5x2ja2
• Heterogens: MN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5x2jA (A:)
  mafelpnlpygfralephidqqtmeihhdkhhntyvtklnaavegtdlesksieeivanl
  dsvpeniqtavrnnggghlnhslfwelltpnseekgtvvdkikeqwgsldafkeefanqa
  aarfgsgwawlvvndgkleivttpnqdnpltegktpilgldvwehayylkyqnkrpdyis
  afwnvvnwekvdelynaak