PDB entry 5x2i

View 5x2i on RCSB PDB site
Description: Polygalacturonate Lyase by Fusing with a Self-assembling Amphipathic Peptide
Class: lyase
Keywords: tag-fusion enzyme, protein stability, hydrophobic force, LYASE
Deposited on 2017-01-31, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pectate lyase
    Species: Bacillus subtilis subsp. subtilis str. 168 [TaxId:224308]
    Gene: pel, BSU07560
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5x2ia_
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5x2iA (A:)
    adlghqtlgsndgwgaystgttggskasssnvytvsnrnqlvsalgketnttpkiiyikg
    tidmnvddnlkplglndykdpeydldkylkaydpstwgkkepsgtqeeararsqknqkar
    vmvdipanttivgsgtnakvvggnfqiksdnviirniefqdaydyfpqwdptdgssgnwn
    sqydnitinggthiwidhctfndgsrpdstspkyygrkyqhhdgqtdasnganyitmsyn
    yyhdhdkssifgssdsktsddgklkitlhhnryknivqraprvrfgqvhvynnyyegsts
    sssypfsyawgigksskiyaqnnvidvpglsaaktisvfsggtalydsgtllngtqinas
    aanglsssvgwtpslhgsidasanvksnvinqagagkln