PDB entry 5x2a

View 5x2a on RCSB PDB site
Description: Crystal structure of EGFR 696-1022 T790M/V948R in complex with SKLB(3)
Class: transferase
Keywords: egfr, t790m, v948r, sklb, transferase
Deposited on 2017-01-31, released 2018-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-21, with a file datestamp of 2018-02-16.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
      • engineered mutation (256)
    Domains in SCOPe 2.07: d5x2aa_
  • Chain 'B':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (Start-330)
      • engineered mutation (98)
      • engineered mutation (256)
    Domains in SCOPe 2.07: d5x2ab_
  • Chain 'C':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
      • engineered mutation (256)
    Domains in SCOPe 2.07: d5x2ac_
  • Chain 'D':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
      • engineered mutation (256)
    Domains in SCOPe 2.07: d5x2ad_
  • Heterogens: CL, EDO, 7XO, ANP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5x2aA (A:)
    gstsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x2aA (A:)
    nqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankei
    ldeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcv
    qiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllvpikwmalesilhriyt
    hqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimrkcwm
    idadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5x2aB (B:)
    gstsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x2aB (B:)
    nqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankei
    ldeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcv
    qiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpik
    wmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppic
    tidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermlpsptdsnfyra
    lmdeedmddvvdadeylipqqg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5x2aC (C:)
    gstsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x2aC (C:)
    nqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankei
    ldeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcv
    qiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllvpikwmalesilhriyt
    hqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimrkcwm
    idadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmddvvd
    ade
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5x2aD (D:)
    gstsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x2aD (D:)
    qallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelrepkankeildea
    yvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvqiak
    gmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgakvpikwmalesilhriyth
    qsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimrkcwmi
    dadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeevvdad