PDB entry 5x1x

View 5x1x on RCSB PDB site
Description: Solution NMR Structure of DNA Mismatch Repair Protein MutT (Family Nudix Hydrolase) from Methicillin Resistant Staphylococcus aureus 252
Class: hydrolase
Keywords: divalent ion (Mg2+, Ca2+) binding protein, adenosine monophosphate (AMP) binding protein, HYDROLASE
Deposited on 2017-01-27, released 2017-02-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-02-22, with a file datestamp of 2017-02-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Mutator mutT protein
  Species: Staphylococcus aureus subsp. aureus MN8 [TaxId:548470]
  Gene: HMPREF0769_10658
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A0E1XLJ5 (0-129)
  Domains in SCOPe 2.08: d5x1xa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5x1xA (A:)
  mkkvinvvgaiifsdnkilcaqrsekmslplmwefpggkveknetekdalireireemkc
  dlivgdkvitteheydfgivrlttykctlnkelptltehksiewlsineldklnwapadi
  pavnkimteg