PDB entry 5x1o

View 5x1o on RCSB PDB site
Description: PI(4,5)P2 lipid binding induced a reorientation of FGF2 molecules near membrane surface to facilitate the unconventional oligomerization-dependent secretion process as revealed by a combined FTIR/NMR/X-ray study
Class: protein binding
Keywords: PI(4, 5)P2, Fibroblast growth factor 2, PROTEIN BINDING
Deposited on 2017-01-26, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF2, FGFB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5x1oa_
  • Chain 'B':
    Compound: fibroblast growth factor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF2, FGFB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5x1ob_
  • Heterogens: I3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5x1oA (A:)
    palpedggsgafppghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeer
    gvvsikgvcanrylamkedgrllaskcvtdecffferlesnnyntyrsrkytswyvalkr
    tgqyklgsktgpgqkailflpmsaks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x1oA (A:)
    kdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvcanrylamk
    edgrllaskcvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqkai
    lflpmsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5x1oB (B:)
    palpedggsgafppghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeer
    gvvsikgvcanrylamkedgrllaskcvtdecffferlesnnyntyrsrkytswyvalkr
    tgqyklgsktgpgqkailflpmsaks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x1oB (B:)
    kdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvcanrylamk
    edgrllaskcvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqkai
    lflpmsa