PDB entry 5wyp

View 5wyp on RCSB PDB site
Description: Crystal structure of DNA polymerase sliding clamp from Caulobacter crescentus
Class: transferase
Keywords: Transferase, DNA binding, Protein binding, Homodimer
Deposited on 2017-01-15, released 2018-03-21
Made obsolete by 6izo on 2019-11-27

The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase III subunit beta
    Species: Caulobacter crescentus CB15 [TaxId:190650]
    Gene: dnaN, CC_0156
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wypa1, d5wypa2, d5wypa3
  • Chain 'B':
    Compound: DNA polymerase III subunit beta
    Species: Caulobacter crescentus CB15 [TaxId:190650]
    Gene: dnaN, CC_0156
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wypb1, d5wypb2, d5wypb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5wypA (A:)
    mkltieraallkalghvqsvverrntipilsnillsaegdrlsfsatdldmeiidegfaq
    idvpgqitapahtlyeivrklpdgadvslsfsgddprlviqagrsrfnlpvlpagdfpvm
    ssdglssriavdtnelirlidktrfaisteetryylnglyvhtvneggetklravatdgh
    rlalaempapegavgipgvivprktiaearrlmesagetvdlqvspqkvrfefgaaalts
    kvidgafpdymrviprdnakiltldndlfakavdrvatisaeksrsvklavepgritltv
    rnmeagqaveevevdydgepfeigfnarylldvcgqiagpqaefrfadpasptlvvdpvd
    pgvkyvlmplrv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5wypB (B:)
    mkltieraallkalghvqsvverrntipilsnillsaegdrlsfsatdldmeiidegfaq
    idvpgqitapahtlyeivrklpdgadvslsfsgddprlviqagrsrfnlpvlpagdfpvm
    ssdglssriavdtnelirlidktrfaisteetryylnglyvhtvneggetklravatdgh
    rlalaempapegavgipgvivprktiaearrlmesagetvdlqvspqkvrfefgaaalts
    kvidgafpdymrviprdnakiltldndlfakavdrvatisaeksrsvklavepgritltv
    rnmeagqaveevevdydgepfeigfnarylldvcgqiagpqaefrfadpasptlvvdpvd
    pgvkyvlmplrv