PDB entry 5wyn

View 5wyn on RCSB PDB site
Description: HtrA2 Pathogenic Mutant
Class: hydrolase
Keywords: Neurodegeneration, Pathogenic Mutant, HYDROLASE
Deposited on 2017-01-13, released 2018-08-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine protease HTRA2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: HTRA2, OMI, PRSS25
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43464 (Start-325)
      • engineered mutation (143)
      • engineered mutation (295)
      • expression tag (326)
    Domains in SCOPe 2.08: d5wyna1, d5wyna2, d5wyna3
  • Heterogens: CL, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wynA (A:)
    mavpspppasprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadgl
    ivtnahvvadrrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvr
    qgefvvamgspfalqntitsgivcsaqrpardlglpqtnveyiqtdaaidfgnsggplvn
    ldgevigvntmkvtagisfaipsdrlreflhrgekknsssgisgsqrryigvmmltlsps
    ilaelqlrepsfpdvqhgvlihkvilgspahraglrpgdvilaigeqmvqnaedvweavr
    tqsqlavqirrgretltlyvtpevtehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wynA (A:)
    asprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnahvv
    adrrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvvam
    gspfalqntitsgivcsaqnveyiqtdaaidfgnsggplvnldgevigvntmkvtagisf
    aipsdrlreflhrryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilgspahrag
    lrpgdvilaigeqmvqnaedvweavrtqsqlavqirrgretltlyvtpevteh