PDB entry 5ww0

View 5ww0 on RCSB PDB site
Description: Crystal structure of Set7, a novel histone methyltransferase in Schizossacharomyces pombe
Class: transcription
Keywords: Histone, methytransferase, Schizosaccharomyces pombe SET7, Epigenetic, TRANSCRIPTION
Deposited on 2016-12-30, released 2017-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SET domain-containing protein 7
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: set7, SPCC297.04c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ww0a_
  • Chain 'B':
    Compound: SET domain-containing protein 7
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: set7, SPCC297.04c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y7Q6 (6-End)
      • cloning site residue (0-5)
    Domains in SCOPe 2.07: d5ww0b1, d5ww0b2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ww0A (A:)
    aghmtsmripvirspleirdterkgrgvfalepipaqtcieispvlmfskeeyeqhgqyt
    vlneytyvwsegkqglalglgsmfnhdrhpnvywkkdnrnnyisyytlreiktneelcis
    ygdhlwfedeassasrispneenedfplqnislletmypydvpdyaapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ww0A (A:)
    ripvirspleirdterkgrgvfalepipaqtcieispvlmfskeeyeqhgqytvlneyty
    vwsegkqglalglgsmfnhdrhpnvywkkdnrnnyisyytlreiktneelcisygdhlwf
    ede
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ww0B (B:)
    aghmtsmripvirspleirdterkgrgvfalepipaqtcieispvlmfskeeyeqhgqyt
    vlneytyvwsegkqglalglgsmfnhdrhpnvywkkdnrnnyisyytlreiktneelcis
    ygdhlwfedeassasrispneenedfplqnislletmypydvpdyaapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ww0B (B:)
    aghmtsmripvirspleirdterkgrgvfalepipaqtcieispvlmfskeeyeqhgqyt
    vlneytyvwsegkqglalglgsmfnhdrhpnvywkkdnrnnyisyytlreiktneelcis