PDB entry 5wut

View 5wut on RCSB PDB site
Description: Crystal structure of laminarinase from Flavobacterium sp. UMI-01
Class: hydrolase
Keywords: laminarinase, glycosidic bond, thermostability, b-jelly roll fold, HYDROLASE
Deposited on 2016-12-21, released 2018-01-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-03, with a file datestamp of 2017-12-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ULam111
    Species: Flavobacterium sp. [TaxId:239]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WUT (Start-234)
    Domains in SCOPe 2.07: d5wuta_
  • Chain 'B':
    Compound: ULam111
    Species: Flavobacterium sp. [TaxId:239]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WUT (Start-234)
    Domains in SCOPe 2.07: d5wutb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wutA (A:)
    mtkgkklvweehfngkeldtknwnfelgdgcpncgwgnserqlytktnhkmengklvita
    kkegtqytstrittqgkkefqygyiearaklpvgkgiwpafwmlgsniktvgwpqcgeid
    ileyvgkephmvftslhttashgntintkrtridtieqgfhlyaidwtkdkmdffvdnil
    vytfnptdkteaiwpydqpfyfiinmaiggnfggpevddaifpqdfsidyikvyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wutA (A:)
    klvweehfngkeldtknwnfelgdgcpncgwgnserqlytktnhkmengklvitakkegt
    qytstrittqgkkefqygyiearaklpvgkgiwpafwmlgsniktvgwpqcgeidileyv
    gkephmvftslhttashgntintkrtridtieqgfhlyaidwtkdkmdffvdnilvytfn
    ptdkteaiwpydqpfyfiinmaiggnfggpevddaifpqdfsidyikvyq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wutB (B:)
    mtkgkklvweehfngkeldtknwnfelgdgcpncgwgnserqlytktnhkmengklvita
    kkegtqytstrittqgkkefqygyiearaklpvgkgiwpafwmlgsniktvgwpqcgeid
    ileyvgkephmvftslhttashgntintkrtridtieqgfhlyaidwtkdkmdffvdnil
    vytfnptdkteaiwpydqpfyfiinmaiggnfggpevddaifpqdfsidyikvyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wutB (B:)
    klvweehfngkeldtknwnfelgdgcpncgwgnserqlytktnhkmengklvitakkegt
    qytstrittqgkkefqygyiearaklpvgkgiwpafwmlgsniktvgwpqcgeidileyv
    gkephmvftslhttashgntintkrtridtieqgfhlyaidwtkdkmdffvdnilvytfn
    ptdkteaiwpydqpfyfiinmaiggnfggpevddaifpqdfsidyikvyq