PDB entry 5wtz

View 5wtz on RCSB PDB site
Description: Crystal structure of C. perfringens iota-like enterotoxin CPILE-a with NAD+
Class: toxin
Keywords: bacterial toxin, actin, CPILE-a, ADP-ribosylation, TOXIN
Deposited on 2016-12-15, released 2017-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-01, with a file datestamp of 2017-02-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Binary enterotoxin of Clostridium perfringens component a
    Species: Clostridium perfringens [TaxId:1502]
    Gene: becA
    Database cross-references and differences (RAF-indexed):
    • Uniprot X5I2D7 (2-420)
      • expression tag (1)
    Domains in SCOPe 2.07: d5wtza1, d5wtza2, d5wtza3
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wtzA (A:)
    gsmlddnrpmdfakdknsatlwakkrkqvwlnnlskaestsinnyiknsseinsysikkk
    faldnyegietlnedlknistavkksmltkplyvyyyeandkfgfnqnlessldsniide
    eainnfakkisdtnfiqdgfkdvtmtepdinsklpilvhlklptntpaasygndeenlrv
    lidqgyslkatglsivtikgkqyakvdadlikqlnfendvisasqwgeenyapwlkelts
    nelrdinnylgggytainkylldgtigentskedleekisnissalkkrkipediityrr
    mgpnefgldlnspdydfnkvenvskfkekwlgktipvktfisttvlsnnisafakrklil
    rlhlpngsnaayvsvaegykneyevlidhgysykidniteyydesslggktnkliidatl
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wtzA (A:)
    smlddnrpmdfakdknsatlwakkrkqvwlnnlskaestsinnyiknsseinsysikkkf
    aldnyegietlnedlknistavkksmltkplyvyyyeandkfgfnqnlessldsniidee
    ainnfakkisdtnfiqdgfkdvtmtepdinsklpilvhlklptntpaasygndeenlrvl
    idqgyslkatglsivtikgkqyakvdadlikqlnfendvisasqwgeenyapwlkeltsn
    elrdinnylgggytainkylldgtigentskedleekisnissalkkrkipediityrrm
    gpnefgldlnspdydfnkvenvskfkekwlgktipvktfisttvlsnnisafakrklilr
    lhlpngsnaayvsvaegykneyevlidhgysykidniteyydesslggktnkliidatli