PDB entry 5wts

View 5wts on RCSB PDB site
Description: Green fluorescent protein linked peptide inhibitor PMI in complex with mdm2
Class: ligase/ligase inhibitor
Keywords: Complex, LIGASE-LIGASE INHIBITOR complex
Deposited on 2016-12-14, released 2017-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein linked PMI inhibitor
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WTS
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wtsb_
  • Heterogens: GOL, PO4, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wtsB (B:)
    gpmsvptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimt
    krlydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdsgtsvs
    en
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wtsB (B:)
    ttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhi
    vycsndllgdlfgvpsfsvkehrkiytmiyrnlvvv