PDB entry 5wt2

View 5wt2 on RCSB PDB site
Description: NifS from Helicobacter pylori
Class: transferase
Keywords: Iron-sulfur cluster biogenesis, cysteine desulfurase, TRANSFERASE
Deposited on 2016-12-09, released 2017-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine desulfurase IscS
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: iscS, HP_0220
    Database cross-references and differences (RAF-indexed):
    • Uniprot O25008
      • engineered mutation (1)
      • engineered mutation (137)
    Domains in SCOPe 2.07: d5wt2a_
  • Heterogens: PLP, IPA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wt2A (A:)
    mvqriyldnnattridpkvkeimdpflrdhygnpsslhqfgtethpaiaealdklykgin
    ardiddviitscatesnnwvlkgvyfdeclkkgknhivttvaehpavrstcnfleslgve
    vtylpinehgsitaeqvreaitektalvsvmwannetglifpieeigaickekgvlfhtd
    avqaigkipvdvlkanadflsfsahkfhgpkgigglyirsgvgltplfhggehmngrrsg
    tlnvpyivgmgeamklavehldyekevvgklrdkleeallkipdvmvvgdrihrvpnttl
    vsvrgiegeamlwdlnrsniaastgsacasedleanpvmvaigaskelahtairlslsrf
    nteaeidktievfsqaavrlrnisssyvdlvprgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wt2A (A:)
    vqriyldnnattridpkvkeimdpflrdhygnpsslhqfgtethpaiaealdklykgina
    rdiddviitscatesnnwvlkgvyfdeclkkgknhivttvaehpavrstcnfleslgvev
    tylpinehgsitaeqvreaitektalvsvmwannetglifpieeigaickekgvlfhtda
    vqaigkipvdvlkanadflsfsahkfhgpkgigglyirsgvgltplfhggehmngrrsgt
    lnvpyivgmgeamklavehldyekevvgklrdkleeallkipdvmvvgdrihrvpnttlv
    svrgiegeamlwdlnrsniaastgsatairlslsrfnteaeidktievfsqaavr