PDB entry 5wsk

View 5wsk on RCSB PDB site
Description: Structure of Ribulose-1,5-bisphosphate carboxylase/oxygenase from wheat
Class: lyase
Keywords: Activited Rubisco, wheat, LYASE
Deposited on 2016-12-07, released 2018-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-14, with a file datestamp of 2018-02-09.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: TRITICUM AESTIVUM [TaxId:4565]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wska1, d5wska2
  • Chain 'B':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: TRITICUM AESTIVUM [TaxId:4565]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wskb1, d5wskb2
  • Chain 'C':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: TRITICUM AESTIVUM [TaxId:4565]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wskc1, d5wskc2
  • Chain 'D':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: TRITICUM AESTIVUM [TaxId:4565]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wskd1, d5wskd2
  • Chain 'E':
    Compound: ribulose bisphosphate carboxylase small chain
    Species: TRITICUM AESTIVUM [TaxId:4565]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wske_
  • Chain 'F':
    Compound: ribulose bisphosphate carboxylase small chain
    Species: TRITICUM AESTIVUM [TaxId:4565]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wskf_
  • Chain 'G':
    Compound: ribulose bisphosphate carboxylase small chain
    Species: TRITICUM AESTIVUM [TaxId:4565]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wskg_
  • Chain 'H':
    Compound: ribulose bisphosphate carboxylase small chain
    Species: TRITICUM AESTIVUM [TaxId:4565]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wskh_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wskA (A:)
    mspqtetkagvgfkagvkdykltyytpeyetkdtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyhiepvagedsqwicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripptysktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygracyeclrggldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghyl
    natagtceemikravfarelgvpivmhdyltggftanttlahycrdnglllhihramhav
    idrqknhgmhfrvlakalrmsggdhihsgtvvgklegeremtlgfvdllrddfiekdrar
    gifftqdwvsmpgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgaaan
    rvaleacvqarnegrdlaregneiiraackwspelaaacevwkaikfefepvdtidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wskA (A:)
    ltyytpeyetkdtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltsldryk
    grcyhiepvagedsqwicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlrip
    ptysktfqgpphgiqverdklnkygrpllgctikpklglsaknygracyeclrggldftk
    ddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghylnatagtceemikravfarelg
    vpivmhdyltggftanttlahycrdnglllhihramhavidrqknhgmhfrvlakalrms
    ggdhihsgtvvgegeremtlgfvdllrddfiekdrargifftqdwvsmpgvipvasggih
    vwhmpalteifgddsvlqfgggtlghpwgnapgaaanrvaleacvqarnegrdlaregne
    iiraackwspelaaacevwka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wskB (B:)
    mspqtetkagvgfkagvkdykltyytpeyetkdtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyhiepvagedsqwicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripptysktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygracyeclrggldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghyl
    natagtceemikravfarelgvpivmhdyltggftanttlahycrdnglllhihramhav
    idrqknhgmhfrvlakalrmsggdhihsgtvvgklegeremtlgfvdllrddfiekdrar
    gifftqdwvsmpgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgaaan
    rvaleacvqarnegrdlaregneiiraackwspelaaacevwkaikfefepvdtidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wskB (B:)
    ltyytpeyetkdtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltsldryk
    grcyhiepvagedsqwicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlrip
    ptysktfqgpphgiqverdklnkygrpllgctikpklglsaknygracyeclrggldftk
    ddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghylnatagtceemikravfarelg
    vpivmhdyltggftanttlahycrdnglllhihramhavidrqknhgmhfrvlakalrms
    ggdhihsgtvvgeremtlgfvdllrddfiekdrargifftqdwvsmpgvipvasggihvw
    hmpalteifgddsvlqfgggtlghpwgnapgaaanrvaleacvqarnegrdlaregneii
    raackwspelaaacevwka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5wskC (C:)
    mspqtetkagvgfkagvkdykltyytpeyetkdtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyhiepvagedsqwicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripptysktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygracyeclrggldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghyl
    natagtceemikravfarelgvpivmhdyltggftanttlahycrdnglllhihramhav
    idrqknhgmhfrvlakalrmsggdhihsgtvvgklegeremtlgfvdllrddfiekdrar
    gifftqdwvsmpgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgaaan
    rvaleacvqarnegrdlaregneiiraackwspelaaacevwkaikfefepvdtidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wskC (C:)
    ykltyytpeyetkdtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltsldr
    ykgrcyhiepvagedsqwicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlr
    ipptysktfqgpphgiqverdklnkygrpllgctikpklglsaknygracyeclrggldf
    tkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghylnatagtceemikravfare
    lgvpivmhdyltggftanttlahycrdnglllhihramhavidrqknhgmhfrvlakalr
    msggdhihsgtvgeremtlgfvdllrddfiekdrargifftqdwvsmpgvipvasggihv
    whmpalteifgddsvlqfgggtlghpwgnapgaaanrvaleacvqarnegrdlaregnei
    iraackwspelaaacevwka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5wskD (D:)
    mspqtetkagvgfkagvkdykltyytpeyetkdtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyhiepvagedsqwicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripptysktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygracyeclrggldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghyl
    natagtceemikravfarelgvpivmhdyltggftanttlahycrdnglllhihramhav
    idrqknhgmhfrvlakalrmsggdhihsgtvvgklegeremtlgfvdllrddfiekdrar
    gifftqdwvsmpgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgaaan
    rvaleacvqarnegrdlaregneiiraackwspelaaacevwkaikfefepvdtidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wskD (D:)
    ltyytpeyetkdtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltsldryk
    grcyhiepvagedsqwicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlrip
    ptysktfqgpphgiqverdklnkygrpllgctikpklglsaknygracyeclrggldftk
    ddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghylnatagtceemikravfarelg
    vpivmhdyltggftanttlahycrdnglllhihramhavidrqknhgmhfrvlakalrms
    ggdhihsgtvvggeremtlgfvdllrddfiekdrargifftqdwvsmpgvipvasggihv
    whmpalteifgddsvlqfgggtlghpwgnapgaaanrvaleacvqarnegrdlaregnei
    iraackwspelaaacevwka
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5wskE (E:)
    maptvmassatsvapfqglkstaglpvsrrsngaslgsvsnggrircmqvwpiegikkfe
    tlsylpplsteallkqvdylirskwvpclefskvgfifrehnaspgyydgrywtmwklpm
    fgctdatqvineveevkkeypdayvriigfdnmrqvqcvsfiafkppgceesgka
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wskE (E:)
    mqvwpiegikkfetlsylpplsteallkqvdylirskwvpclefskvgfifrehnaspgy
    ydgrywtmwklpmfgctdatqvineveevkkeypdayvriigfdnmrqvqcvsfiafkpp
    gc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5wskF (F:)
    maptvmassatsvapfqglkstaglpvsrrsngaslgsvsnggrircmqvwpiegikkfe
    tlsylpplsteallkqvdylirskwvpclefskvgfifrehnaspgyydgrywtmwklpm
    fgctdatqvineveevkkeypdayvriigfdnmrqvqcvsfiafkppgceesgka
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wskF (F:)
    mqvwpiegikkfetlsylpplsteallkqvdylirskwvpclefskvgfifrehnaspgy
    ydgrywtmwklpmfgctdatqvineveevkkeypdayvriigfdnmrqvqcvsfiafkpp
    gc
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5wskG (G:)
    maptvmassatsvapfqglkstaglpvsrrsngaslgsvsnggrircmqvwpiegikkfe
    tlsylpplsteallkqvdylirskwvpclefskvgfifrehnaspgyydgrywtmwklpm
    fgctdatqvineveevkkeypdayvriigfdnmrqvqcvsfiafkppgceesgka
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wskG (G:)
    mqvwpiegikkfetlsylpplsteallkqvdylirskwvpclefskvgfifrehnaspgy
    ydgrywtmwklpmfgctdatqvineveevkkeypdayvriigfdnmrqvqcvsfiafkpp
    gc
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5wskH (H:)
    maptvmassatsvapfqglkstaglpvsrrsngaslgsvsnggrircmqvwpiegikkfe
    tlsylpplsteallkqvdylirskwvpclefskvgfifrehnaspgyydgrywtmwklpm
    fgctdatqvineveevkkeypdayvriigfdnmrqvqcvsfiafkppgceesgka
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wskH (H:)
    mqvwpiegikkfetlsylpplsteallkqvdylirskwvpclefskvgfifrehnaspgy
    ydgrywtmwklpmfgctdatqvineveevkkeypdayvriigfdnmrqvqcvsfiafkpp