PDB entry 5ws7
View 5ws7 on RCSB PDB site
Description: Crystal structure of human MTH1(G2K/C87A/C104S mutant) in complex with 2-oxo-dATP
Class: hydrolase
Keywords: alpha-beta-alpha sandwich, hydrolase, DNA damage, DNA repair, DNA replication
Deposited on
2016-12-05, released
2017-01-04
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-09-27, with a file datestamp of
2017-09-22.
Experiment type: XRAY
Resolution: 1 Å
R-factor: N/A
AEROSPACI score: 0.82
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: 7,8-dihydro-8-oxoguanine triphosphatase
Species: Homo sapiens [TaxId:9606]
Gene: NUDT1, MTH1
Database cross-references and differences (RAF-indexed):
- Uniprot P36639 (0-155)
- engineered mutation (1)
- engineered mutation (86)
- engineered mutation (103)
Domains in SCOPe 2.08: d5ws7a_ - Chain 'B':
Compound: 7,8-dihydro-8-oxoguanine triphosphatase
Species: Homo sapiens [TaxId:9606]
Gene: NUDT1, MTH1
Database cross-references and differences (RAF-indexed):
- Uniprot P36639 (0-155)
- engineered mutation (1)
- engineered mutation (86)
- engineered mutation (103)
Domains in SCOPe 2.08: d5ws7b_ - Heterogens: 6U4, NA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>5ws7A (A:)
mkasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesglt
vdalhkvgqivfefvgepelmdvhvfatdsiqgtpvesdemrpswfqldqipfkdmwpdd
sywfplllqkkkfhgyfkfqgqdtildytlrevdtv
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>5ws7B (B:)
mkasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesglt
vdalhkvgqivfefvgepelmdvhvfatdsiqgtpvesdemrpswfqldqipfkdmwpdd
sywfplllqkkkfhgyfkfqgqdtildytlrevdtv