PDB entry 5wry

View 5wry on RCSB PDB site
Description: Structure of human PARP1 catalytic domain bound to a quinazoline-2,4(1H,3H)-dione inhibitor
Class: transferase/transferase inhibitor
Keywords: Inhibitor, Complex, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2016-12-04, released 2017-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly [ADP-ribose] polymerase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09874 (2-351)
      • expression tag (0-1)
      • engineered mutation (102)
    Domains in SCOPe 2.07: d5wrya1, d5wrya2, d5wrya3
  • Chain 'B':
    Compound: Poly [ADP-ribose] polymerase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09874 (2-351)
      • expression tag (0-1)
      • engineered mutation (102)
    Domains in SCOPe 2.07: d5wryb1, d5wryb2, d5wryb3
  • Heterogens: 4YR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wryA (A:)
    hmksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqa
    vsqgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllr
    ggsddsskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifki
    eregecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfad
    mvsksanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdps
    anisldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wryA (A:)
    hmksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqa
    vsqgsdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrg
    gsddsskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifkie
    regecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadm
    vsksanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsa
    nisldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfkt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5wryB (B:)
    hmksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqa
    vsqgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllr
    ggsddsskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifki
    eregecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfad
    mvsksanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdps
    anisldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfkt