PDB entry 5wqq

View 5wqq on RCSB PDB site
Description: High resolution structure of high-potential iron-sulfur protein in the oxidized state
Class: metal binding protein
Keywords: iron-sulfur protein, metal-binding protein, METAL BINDING PROTEIN
Deposited on 2016-11-28, released 2017-06-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: XRAY
Resolution: 0.8 Å
R-factor: N/A
AEROSPACI score: 1.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: high-potential iron-sulfur protein
  Species: Thermochromatium tepidum [TaxId:1050]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80176 (0-82)
  Domains in SCOPe 2.06: d5wqqa_
• Heterogens: SF4, SO4, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5wqqA (A:)
  aapanavtaddptaialkynqdatkservaaarpglppeeqhcancqfmqanvgegdwkg
  cqlfpgklinvngwcaswtlkag