PDB entry 5wqm

View 5wqm on RCSB PDB site
Description: Crystal structure of a carbonyl reductase from Pseudomonas aeruginosa PAO1 (condition I)
Class: oxidoreductase
Keywords: short chain dehydrogenase/reductase, OXIDOREDUCTASE
Deposited on 2016-11-27, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable dehydrogenase
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA4079
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wqma_
  • Chain 'B':
    Compound: Probable dehydrogenase
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA4079
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wqmb_
  • Chain 'C':
    Compound: Probable dehydrogenase
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA4079
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wqmc_
  • Chain 'D':
    Compound: Probable dehydrogenase
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA4079
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wqmd_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wqmA (A:)
    mhnvlivgasrgiglgladaflqrgaqvfavarrpqgspglqalaeragerlqavtgdln
    qhdcaerigemlgerridrlivnagiygpqqqdvaeidaeqtaqlfltnaiaplrlaral
    sgrvsrggvvafmssqmaslalglsatmplygaskaalnslvrswegefeelpfsllllh
    pgwvrtemggdsaplsveesaaglvaavedaagvnacrfvdyrnqplpw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wqmA (A:)
    mhnvlivgasrgiglgladaflqrgaqvfavarrpqgspglqalaeragerlqavtgdln
    qhdcaerigemlgerridrlivnagiygpqqqdvaeidaeqtaqlfltnaiaplrlaral
    sgrvsrggvvafmssqmaslalglsatmplygaskaalnslvrswegefeelpfsllllh
    pgwlsveesaaglvaavedaagvnacrfvdyrnqplpw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wqmB (B:)
    mhnvlivgasrgiglgladaflqrgaqvfavarrpqgspglqalaeragerlqavtgdln
    qhdcaerigemlgerridrlivnagiygpqqqdvaeidaeqtaqlfltnaiaplrlaral
    sgrvsrggvvafmssqmaslalglsatmplygaskaalnslvrswegefeelpfsllllh
    pgwvrtemggdsaplsveesaaglvaavedaagvnacrfvdyrnqplpw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wqmB (B:)
    mhnvlivgasrgiglgladaflqrgaqvfavarrpqgspglqalaeragerlqavtgdln
    qhdcaerigemlgerridrlivnagiygpqqqdvaeidaeqtaqlfltnaiaplrlaral
    sgrvsrggvvafmssqmaslalglsatmplygaskaalnslvrswegefeelpfsllllh
    pgwlsveesaaglvaavedaagvnacrfvdyrnqplpw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5wqmC (C:)
    mhnvlivgasrgiglgladaflqrgaqvfavarrpqgspglqalaeragerlqavtgdln
    qhdcaerigemlgerridrlivnagiygpqqqdvaeidaeqtaqlfltnaiaplrlaral
    sgrvsrggvvafmssqmaslalglsatmplygaskaalnslvrswegefeelpfsllllh
    pgwvrtemggdsaplsveesaaglvaavedaagvnacrfvdyrnqplpw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wqmC (C:)
    mhnvlivgasrgiglgladaflqrgaqvfavarrpqgspglqalaeragerlqavtgdln
    qhdcaerigemlgerridrlivnagiygpqqqdvaeidaeqtaqlfltnaiaplrlaral
    sgrvsrggvvafmssqmaslalglsatmplygaskaalnslvrswegefeelpfsllllh
    pgwlsveesaaglvaavedaagvnacrfvdyrnqplpw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5wqmD (D:)
    mhnvlivgasrgiglgladaflqrgaqvfavarrpqgspglqalaeragerlqavtgdln
    qhdcaerigemlgerridrlivnagiygpqqqdvaeidaeqtaqlfltnaiaplrlaral
    sgrvsrggvvafmssqmaslalglsatmplygaskaalnslvrswegefeelpfsllllh
    pgwvrtemggdsaplsveesaaglvaavedaagvnacrfvdyrnqplpw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wqmD (D:)
    mhnvlivgasrgiglgladaflqrgaqvfavarrpqgspglqalaeragerlqavtgdln
    qhdcaerigemlgerridrlivnagiygpqqqdvaeidaeqtaqlfltnaiaplrlaral
    sgrvsrggvvafmssqmaslalglsatmplygaskaalnslvrswegefeelpfsllllh
    pgwlsveesaaglvaavedaagvnacrfvdyrnqplpw