PDB entry 5wql

View 5wql on RCSB PDB site
Description: Structure of a PDZ-protease bound to a substrate-binding adaptor
Class: protein binding/signaling protein/hydrolase/peptide
Keywords: Prc, NlpI, protein degradation, peptidoglycan, PROTEIN BINDING-SIGNALING PROTEIN-HYDROLASE-PEPTIDE complex
Deposited on 2016-11-27, released 2017-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipoprotein nlpI
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: nlpi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AFB1 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d5wqla1, d5wqla2
  • Chain 'B':
    Compound: Lipoprotein nlpI
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: nlpi
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wqlb_
  • Chain 'C':
    Compound: Tail-specific protease
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: prc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23865
      • engineered mutation (476)
  • Chain 'D':
    Compound: Tail-specific protease
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: prc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23865
      • engineered mutation (476)
  • Chain 'E':
    Compound: ala-ala-ala-ala
    Species: Escherichia coli K-12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WQL (0-3)
  • Chain 'F':
    Compound: ala-ala-ala-ala-ala-ala
    Species: Escherichia coli K-12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WQL (0-5)
  • Chain 'G':
    Compound: leu-ser-arg-ser
    Species: Escherichia coli K-12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WQL (0-3)
  • Chain 'H':
    Compound: ala-ala-ala-ala-ala-ala
    Species: Escherichia coli K-12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WQL (0-5)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wqlA (A:)
    ghmsntswrksevlavplqptlqqevilarmeqilasraltdderaqllyergvlydslg
    lralarndfsqalairpdmpevfnylgiyltqagnfdaayeafdsvleldptynyahlnr
    gialyyggrdklaqddllafyqddpndpfrslwlylaeqkldekqakevlkqhfeksdke
    qwgwnivefylgniseqtlmerlkadatdntslaehlsetnfylgkyylslgdldsatal
    fklavannvhnfvehryallelsllgqdqddlaesdqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wqlA (A:)
    msntswrksevlavplqptlqqevilarmeqilasraltdderaqllyergvlydslglr
    alarndfsqalairpdmpevfnylgiyltqagnfdaayeafdsvleldptynyahlnrgi
    alyyggrdklaqddllafyqddpndpfrslwlylaeqkldekqakevlkqhfeksdkeqw
    gwnivefylgniseqtlmerlkadatdntslaehlsetnfylgkyylslgdldsatalfk
    lavannvhnfvehryallelsllgqdqddl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wqlB (B:)
    ghmsntswrksevlavplqptlqqevilarmeqilasraltdderaqllyergvlydslg
    lralarndfsqalairpdmpevfnylgiyltqagnfdaayeafdsvleldptynyahlnr
    gialyyggrdklaqddllafyqddpndpfrslwlylaeqkldekqakevlkqhfeksdke
    qwgwnivefylgniseqtlmerlkadatdntslaehlsetnfylgkyylslgdldsatal
    fklavannvhnfvehryallelsllgqdqddlaesdqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wqlB (B:)
    ntswrksevlavplqptlqqevilarmeqilasraltdderaqllyergvlydslglral
    arndfsqalairpdmpevfnylgiyltqagnfdaayeafdsvleldptynyahlnrgial
    yyggrdklaqddllafyqddpndpfrslwlylaeqkldekqakevlkqhfeksdkeqwgw
    nivefylgniseqtlmerlkadatdntslaehlsetnfylgkyylslgdldsatalfkla
    vannvhnfvehryallelsllgqdqddl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.