PDB entry 5wp1

View 5wp1 on RCSB PDB site
Description: Complex of ERK2 with 5,7-dihydroxychromone
Class: transferase
Keywords: signal-regulated kinase, TRANSFERASE
Deposited on 2017-08-03, released 2018-08-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK1, ERK2, PRKM1, PRKM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5wp1a_
  • Heterogens: B7S, SO4, BEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wp1A (A:)
    aaaagagpemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqt
    ycqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsn
    dhicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgf
    lteyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgi
    lgspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrie
    veqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wp1A (A:)
    rgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycqrtlreiki
    llrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyflyqil
    rglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvatrwyr
    apeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqedlnc
    iinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalahpyle
    qyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpg