PDB entry 5wp0

View 5wp0 on RCSB PDB site
Description: Crystal structure of NAD synthetase NadE from Vibrio fischeri
Class: ligase
Keywords: Structural genomics, NIAID, National Institute of Allergy and Infectious Diseases, ALPHA BETA, 3-LAYER(ABA) SANDWICH, ROSSMANN FOLD, NAD SYNTHETASE, LIGASE, Center for Structural Genomics of Infectious Diseases, CSGID
Deposited on 2017-08-03, released 2017-08-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nh(3)-dependent nad(+) synthetase
    Species: Vibrio fischeri (strain ATCC 700601 / ES114) [TaxId:312309]
    Gene: nadE, VF_A0602
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5DZX4 (3-278)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d5wp0a1, d5wp0a2
  • Chain 'B':
    Compound: nh(3)-dependent nad(+) synthetase
    Species: Vibrio fischeri (strain ATCC 700601 / ES114) [TaxId:312309]
    Gene: nadE, VF_A0602
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5DZX4 (3-278)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d5wp0b1, d5wp0b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wp0A (A:)
    fqgmqqqiveemkvkvsidpveeikkrvdfikgklleahckslilgisggvdsttcgrla
    qlavnelnletqssdyqfiavrlpygiqqdedeaqlalqfiqpthsisinikngvdglhs
    anhialkdtgllptdsakidfvkgnvkararmiaqyevagyvgglvlgtdhsaenitgfy
    tkfgdgacdlaplfglnkrqvrevaaqlgapeqlvkkvptadleelapqkadedalsvsy
    dqiddflegkkidadaedrlikiyqmsqhkrkpiptiyd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wp0A (A:)
    fqgmqqqiveemkvkvsidpveeikkrvdfikgklleahckslilgisggvdsttcgrla
    qlavnelnletqssdyqfiavrlpygiqqdedeaqlalqfiqpthsisinikngvdglhs
    anhialkdtgllptdsakidfvkgnvkararmiaqyevagyvgglvlgtdhsaenitgfy
    tkfgdgacdlaplfglnkrqvrevaaqlgapeqlvkksvsydqiddflegkkidadaedr
    likiyqmsqhkrkpiptiyd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wp0B (B:)
    fqgmqqqiveemkvkvsidpveeikkrvdfikgklleahckslilgisggvdsttcgrla
    qlavnelnletqssdyqfiavrlpygiqqdedeaqlalqfiqpthsisinikngvdglhs
    anhialkdtgllptdsakidfvkgnvkararmiaqyevagyvgglvlgtdhsaenitgfy
    tkfgdgacdlaplfglnkrqvrevaaqlgapeqlvkkvptadleelapqkadedalsvsy
    dqiddflegkkidadaedrlikiyqmsqhkrkpiptiyd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wp0B (B:)
    fqgmqqqiveemkvkvsidpveeikkrvdfikgklleahckslilgisggvdsttcgrla
    qlavnelnletqssdyqfiavrlpygiqqdedeaqlalqfiqpthsisinikngvdglhs
    anhialkdtgllptdsakidfvkgnvkararmiaqyevagyvgglvlgtdhsaenitgfy
    tkfgdgacdlaplfglnkrqvrevaaqlgapeqlvkkvptadleelapdalsvsydqidd
    flegkkidadaedrlikiyqmsqhkrkpiptiyd