PDB entry 5woq

View 5woq on RCSB PDB site
Description: Crystal structure of an XRE family protein transcriptional regulator from Mycobacterium smegmatis
Class: transcription
Keywords: NIAID, structural genomics, transcription factor, tuberculosis, clgR, resistance, Rv2745c, Seattle Structural Genomics Center for Infectious Disease, SSGCID, TRANSCRIPTION
Deposited on 2017-08-02, released 2017-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator ClgR
    Species: Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) [TaxId:246196]
    Gene: clgR, MSMEG_2694, MSMEI_2628
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5woqa_
  • Chain 'B':
    Compound: Transcriptional regulator ClgR
    Species: Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) [TaxId:246196]
    Gene: clgR, MSMEG_2694, MSMEI_2628
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5woqb_
  • Chain 'C':
    Compound: Transcriptional regulator ClgR
    Species: Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) [TaxId:246196]
    Gene: clgR, MSMEG_2694, MSMEI_2628
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5woqc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5woqA (A:)
    mahhhhhhmtallrevigdvlrnartdqgrtlrevsdaarvslgylsevergrkeassel
    lsaicdaldvplsrvltdagesmarrehdareaeqvavanlgridaatkvvipqvsmava
    

    Sequence, based on observed residues (ATOM records): (download)
    >5woqA (A:)
    tallrevigdvlrnartdqgrtlrevsdaarvslgylsevergrkeassellsaicdald
    vplsrvltdagesmarrehd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5woqB (B:)
    mahhhhhhmtallrevigdvlrnartdqgrtlrevsdaarvslgylsevergrkeassel
    lsaicdaldvplsrvltdagesmarrehdareaeqvavanlgridaatkvvipqvsmava
    

    Sequence, based on observed residues (ATOM records): (download)
    >5woqB (B:)
    mtallrevigdvlrnartdqgrtlrevsdaarvslgylsevergrkeassellsaicdal
    dvplsrvltdagesmarrehdarea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5woqC (C:)
    mahhhhhhmtallrevigdvlrnartdqgrtlrevsdaarvslgylsevergrkeassel
    lsaicdaldvplsrvltdagesmarrehdareaeqvavanlgridaatkvvipqvsmava
    

    Sequence, based on observed residues (ATOM records): (download)
    >5woqC (C:)
    allrevigdvlrnartdqgrtlrevsdaarvslgylsevergrkeassellsaicdaldv
    plsrvltdagesmarrehdarea