PDB entry 5wof

View 5wof on RCSB PDB site
Description: 1.65 angstrom structure of the dynein light chain 1 from plasmodium falciparum
Class: transport protein
Keywords: structural genomics consortium, dynein light chain, microtube, malaria, sgc, transport protein
Deposited on 2017-08-02, released 2017-08-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein light chain 1, putative
    Species: Plasmodium falciparum [TaxId:36329]
    Gene: PF3D7_1213600, PFL0660w
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8I5R9 (19-101)
      • expression tag (18)
    Domains in SCOPe 2.08: d5wofa1, d5wofa2
  • Chain 'B':
    Compound: Dynein light chain 1, putative
    Species: Plasmodium falciparum [TaxId:36329]
    Gene: PF3D7_1213600, PFL0660w
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8I5R9 (19-101)
      • expression tag (17-18)
    Domains in SCOPe 2.08: d5wofb1, d5wofb2
  • Chain 'C':
    Compound: Dynein light chain 1, putative
    Species: Plasmodium falciparum [TaxId:36329]
    Gene: PF3D7_1213600, PFL0660w
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8I5R9 (19-101)
      • expression tag (17-18)
    Domains in SCOPe 2.08: d5wofc1, d5wofc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wofA (A:)
    mgsshhhhhhssglvprgsvvknvdmteemqidaidcanqalqkynvekdiaahikkefd
    rkydptwhcvvgrnfgsyvthetknfiyfyigqvaillfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wofA (A:)
    svvknvdmteemqidaidcanqalqkynvekdiaahikkefdrkydptwhcvvgrnfgsy
    vthetknfiyfyigqvaillfksg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wofB (B:)
    mgsshhhhhhssglvprgsvvknvdmteemqidaidcanqalqkynvekdiaahikkefd
    rkydptwhcvvgrnfgsyvthetknfiyfyigqvaillfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wofB (B:)
    gsvvknvdmteemqidaidcanqalqkynvekdiaahikkefdrkydptwhcvvgrnfgs
    yvthetknfiyfyigqvaillfksg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5wofC (C:)
    mgsshhhhhhssglvprgsvvknvdmteemqidaidcanqalqkynvekdiaahikkefd
    rkydptwhcvvgrnfgsyvthetknfiyfyigqvaillfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wofC (C:)
    gsvvknvdmteemqidaidcanqalqkynvekdiaahikkefdrkydptwhcvvgrnfgs
    yvthetknfiyfyigqvaillfksg