PDB entry 5wnm

View 5wnm on RCSB PDB site
Description: Crystal structure of murine receptor-interacting protein 4 (Ripk4) D143N bound to tozasertib (VX-680)
Class: transferase/transferase inhibitor
Keywords: Kinase, Inhibitor, Complex, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2017-08-01, released 2018-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor-interacting serine/threonine-protein kinase 4
    Species: Mus musculus [TaxId:10090]
    Gene: Ripk4, Ankrd3, Pkk
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ERK0
      • engineered mutation (142)
    Domains in SCOPe 2.07: d5wnma_
  • Heterogens: CL, VX6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wnmA (A:)
    megegrgrwalgllrtfdagefagwekvgsggfgqvykvrhvhwktwlaikcspslhvdd
    rermelleeakkmemakfryilpvygicqepvglvmeymetgslekllaseplpwdlrfr
    ivhetavgmnflhcmsppllhlnlkpanilldahyhvkisdfglakcngmshshdlsmdg
    lfgtiaylpperireksrlfdtkhdvysfaiviwgvltqkkpfadeknilhimmkvvkgh
    rpelppicrprpracasliglmqrcwhadpqvrptfqeitsetedlcekpdeevkdlahe
    pgeksslesksearpessrlkrasappfdndcslsellsqld
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wnmA (A:)
    algllrtfdagefagwekvgsfgqvykvrhvhwktwlaikcspslhvddrermelleeak
    kmemakfryilpvygicqepvglvmeymetgslekllaseplpwdlrfrivhetavgmnf
    lhcmsppllhlnlkpanilldahyhvkisdfglakfgtiaylpperireksrlfdtkhdv
    ysfaiviwgvltqkkpfadeknilhimmkvvkghrpelppicrprpracasliglmqrcw
    hadpqvrptfqeitsetedlcek