PDB entry 5wna

View 5wna on RCSB PDB site
Description: Structure of antibody 3D3 bound to the central conserved region of RSV G
Class: viral protein/immune system
Keywords: RSV, glycoprotein, G glycoprotein, viral protein, viral attachment protein, antibody, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2017-07-31, released 2018-03-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major surface glycoprotein g
    Species: Human respiratory syncytial virus A [TaxId:11259]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: major surface glycoprotein g
    Species: Human respiratory syncytial virus A [TaxId:11259]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: mAb 3D3 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WNA (0-End)
    Domains in SCOPe 2.08: d5wnac_
  • Chain 'D':
    Compound: mAb 3D3 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WNA (0-End)
    Domains in SCOPe 2.08: d5wnad1, d5wnad2
  • Chain 'H':
    Compound: mAb 3D3 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WNA (0-End)
    Domains in SCOPe 2.08: d5wnah_
  • Chain 'L':
    Compound: mAb 3D3 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WNA (0-End)
    Domains in SCOPe 2.08: d5wnal1, d5wnal2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5wnaC (C:)
    eeqlvesggglvqpgrslrlscvgsglrfeehamhwvrqapgrglewvsgiswnsgsvgy
    adsvkgrfttsrdnakdilflemntlrsedtalyfcaimvattkndfhyykdvwgkgttv
    tvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpav
    lqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkth
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wnaC (C:)
    eeqlvesggglvqpgrslrlscvgsglrfeehamhwvrqapgrglewvsgiswnsgsvgy
    adsvkgrfttsrdnakdilflemntlrsedtalyfcaimvattkndfhyykdvwgkgttv
    tvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpav
    lqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5wnaD (D:)
    qivltqspatlslspgeratlscrasqsvsnhlawyqqkpgqaprlliyetsnratgipp
    rfsgsgsgtdftltisslepedfavyycqqrnnwytfgqgtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wnaD (D:)
    qivltqspatlslspgeratlscrasqsvsnhlawyqqkpgqaprlliyetsnratgipp
    rfsgsgsgtdftltisslepedfavyycqqrnnwytfgqgtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5wnaH (H:)
    eeqlvesggglvqpgrslrlscvgsglrfeehamhwvrqapgrglewvsgiswnsgsvgy
    adsvkgrfttsrdnakdilflemntlrsedtalyfcaimvattkndfhyykdvwgkgttv
    tvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpav
    lqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkth
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wnaH (H:)
    eeqlvesggglvqpgrslrlscvgsglrfeehamhwvrqapgrglewvsgiswnsgsvgy
    adsvkgrfttsrdnakdilflemntlrsedtalyfcaimvattkndfhyykdvwgkgttv
    tvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpav
    lqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5wnaL (L:)
    qivltqspatlslspgeratlscrasqsvsnhlawyqqkpgqaprlliyetsnratgipp
    rfsgsgsgtdftltisslepedfavyycqqrnnwytfgqgtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wnaL (L:)
    qivltqspatlslspgeratlscrasqsvsnhlawyqqkpgqaprlliyetsnratgipp
    rfsgsgsgtdftltisslepedfavyycqqrnnwytfgqgtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrg