PDB entry 5wmm

View 5wmm on RCSB PDB site
Description: Crystal structure of an adenylation domain interrupted by a methylation domain (AMA4) from nonribosomal peptide synthetase TioS
Class: biosynthetic protein
Keywords: Nonribosomal peptide, Thiocoraline, Depsipeptide, Thiolation, Nucleotidyl transferase, N-methylation, BIOSYNTHETIC PROTEIN
Deposited on 2017-07-30, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: nrps
  Species: Micromonospora sp. ML1 [TaxId:349725]
  Gene: tioS
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q333U7
• Chain 'B':
  Compound: MbtH homologue
  Species: Micromonospora sp. ML1 [TaxId:349725]
  Gene: tioT
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q333U6
  Domains in SCOPe 2.07: d5wmmb_
• Heterogens: B6G, SAH, CL, CA, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >5wmmB (B:)
  mgsshhhhhhsqdpnsmsvnpfddedgefyvlvndeeqhslwptfgdvpdgwrivfgpag
  raesvayveenwtdmrpkslreamsaa
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5wmmB (B:)
  svnpfddedgefyvlvndeeqhslwptfgdvpdgwrivfgpagraesvayveenwtdmrp
  kslr