PDB entry 5wmm

View 5wmm on RCSB PDB site
Description: Crystal structure of an adenylation domain interrupted by a methylation domain (AMA4) from nonribosomal peptide synthetase TioS
Class: biosynthetic protein
Keywords: Nonribosomal peptide, Thiocoraline, Depsipeptide, Thiolation, Nucleotidyl transferase, N-methylation, BIOSYNTHETIC PROTEIN
Deposited on 2017-07-30, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nrps
    Species: Micromonospora sp. ML1 [TaxId:349725]
    Gene: tioS
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: MbtH homologue
    Species: Micromonospora sp. ML1 [TaxId:349725]
    Gene: tioT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wmmb_
  • Heterogens: B6G, SAH, CL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wmmB (B:)
    mgsshhhhhhsqdpnsmsvnpfddedgefyvlvndeeqhslwptfgdvpdgwrivfgpag
    raesvayveenwtdmrpkslreamsaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wmmB (B:)
    svnpfddedgefyvlvndeeqhslwptfgdvpdgwrivfgpagraesvayveenwtdmrp
    kslr