PDB entry 5wml

View 5wml on RCSB PDB site
Description: Arabidopsis thaliana Prephenate Aminotransferase mutant- K306A
Class: transferase
Keywords: aspartate aminotransferase, PLP-dependent, TRANSFERASE
Deposited on 2017-07-29, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PAT, AAT, MEE17, At2g22250, T26C19.9
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SIE1
      • engineered mutation (305)
    Domains in SCOPe 2.07: d5wmla_
  • Chain 'B':
    Compound: Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PAT, AAT, MEE17, At2g22250, T26C19.9
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SIE1
      • engineered mutation (305)
    Domains in SCOPe 2.07: d5wmlb_
  • Heterogens: PMP, GLU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wmlA (A:)
    masqssvavissaaargesfpdskkpigsvrfqqplrlsfsycksgnmssricamakpnd
    aetlsssvdmslsprvqslkpsktmvitdlaatlvqsgvpvirlaagepdfdtpkvvaea
    ginairegftrytlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavc
    spgdeviipapywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcs
    psnptgsvypkslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertlt
    vngfsaafamtgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkagget
    vaemvkayrerrdflvkslgdikgvkisepqgafylfidfsayygseaegfglindsssl
    alyfldkfqvamvpgdafgddscirisyatsldvlqaavekirkaleplratvsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wmlA (A:)
    mslsprvqslkpsktmvitdlaatlvqsgvpvirlaagepdfdtpkvvaeaginairegf
    trytlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavcspgdeviip
    apywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcspsnptgsvy
    pkslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertltvngfsaafa
    mtgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkaggetvaemvkayr
    errdflvkslgdikgvkisepqgafylfidfsayygseaegfglindssslalyfldkfq
    vamvpgdafgddscirisyatsldvlqaavekirkaleplratv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wmlB (B:)
    masqssvavissaaargesfpdskkpigsvrfqqplrlsfsycksgnmssricamakpnd
    aetlsssvdmslsprvqslkpsktmvitdlaatlvqsgvpvirlaagepdfdtpkvvaea
    ginairegftrytlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavc
    spgdeviipapywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcs
    psnptgsvypkslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertlt
    vngfsaafamtgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkagget
    vaemvkayrerrdflvkslgdikgvkisepqgafylfidfsayygseaegfglindsssl
    alyfldkfqvamvpgdafgddscirisyatsldvlqaavekirkaleplratvsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wmlB (B:)
    slsprvqslkpsktmvitdlaatlvqsgvpvirlaagepdfdtpkvvaeaginairegft
    rytlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavcspgdeviipa
    pywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcspsnptgsvyp
    kslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertltvngfsaafam
    tgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkaggetvaemvkayre
    rrdflvkslgdikgvkisepqgafylfidfsayygseaegfglindssslalyfldkfqv
    amvpgdafgddscirisyatsldvlqaavekirkaleplrat