PDB entry 5wmh

View 5wmh on RCSB PDB site
Description: Arabidopsis thaliana prephenate aminotransferase
Class: transferase
Keywords: aminotransferase, PLP-dependent, TRANSFERASE
Deposited on 2017-07-28, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PAT, AAT, MEE17, At2g22250, T26C19.9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wmha_
  • Chain 'B':
    Compound: Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PAT, AAT, MEE17, At2g22250, T26C19.9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wmhb_
  • Chain 'C':
    Compound: Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PAT, AAT, MEE17, At2g22250, T26C19.9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wmhc_
  • Chain 'D':
    Compound: Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PAT, AAT, MEE17, At2g22250, T26C19.9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wmhd_
  • Chain 'E':
    Compound: Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PAT, AAT, MEE17, At2g22250, T26C19.9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wmhe_
  • Chain 'F':
    Compound: Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PAT, AAT, MEE17, At2g22250, T26C19.9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wmhf_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wmhA (A:)
    masqssvavissaaargesfpdskkpigsvrfqqplrlsfsycksgnmssricamakpnd
    aetlsssvdmslsprvqslkpsktmvitdlaatlvqsgvpvirlaagepdfdtpkvvaea
    ginairegftrytlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavc
    spgdeviipapywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcs
    psnptgsvypkslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertlt
    vngfskafamtgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkagget
    vaemvkayrerrdflvkslgdikgvkisepqgafylfidfsayygseaegfglindsssl
    alyfldkfqvamvpgdafgddscirisyatsldvlqaavekirkaleplratvsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wmhA (A:)
    slsprvqslkpsktmvitdlaatlvqsgvpvirlaagepdfdtpkvvaeaginairegft
    rytlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavcspgdeviipa
    pywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcspsnptgsvyp
    kslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertltvngfskafam
    tgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkaggetvaemvkayre
    rrdflvkslgdikgvkisepqgafylfidfsayygseaegfglindssslalyfldkfqv
    amvpgdafgddscirisyatsldvlqaavekirkalepl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wmhB (B:)
    masqssvavissaaargesfpdskkpigsvrfqqplrlsfsycksgnmssricamakpnd
    aetlsssvdmslsprvqslkpsktmvitdlaatlvqsgvpvirlaagepdfdtpkvvaea
    ginairegftrytlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavc
    spgdeviipapywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcs
    psnptgsvypkslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertlt
    vngfskafamtgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkagget
    vaemvkayrerrdflvkslgdikgvkisepqgafylfidfsayygseaegfglindsssl
    alyfldkfqvamvpgdafgddscirisyatsldvlqaavekirkaleplratvsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wmhB (B:)
    slsprvqslkpsktmvitdlaatlvqsgvpvirlaagepdfdtpkvvaeaginairegft
    rytlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavcspgdeviipa
    pywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcspsnptgsvyp
    kslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertltvngfskafam
    tgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkaggetvaemvkayre
    rrdflvkslgdikgvkisepqgafylfidfsayygseaegfglindssslalyfldkfqv
    amvpgdafgddscirisyatsldvlqaavekirkalepl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5wmhC (C:)
    masqssvavissaaargesfpdskkpigsvrfqqplrlsfsycksgnmssricamakpnd
    aetlsssvdmslsprvqslkpsktmvitdlaatlvqsgvpvirlaagepdfdtpkvvaea
    ginairegftrytlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavc
    spgdeviipapywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcs
    psnptgsvypkslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertlt
    vngfskafamtgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkagget
    vaemvkayrerrdflvkslgdikgvkisepqgafylfidfsayygseaegfglindsssl
    alyfldkfqvamvpgdafgddscirisyatsldvlqaavekirkaleplratvsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wmhC (C:)
    dmslsprvqslkpsktmvitdlaatlvqsgvpvirlaagepdfdtpkvvaeaginaireg
    ftrytlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavcspgdevii
    papywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcspsnptgsv
    ypkslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertltvngfskaf
    amtgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkaggetvaemvkay
    rerrdflvkslgdikgvkisepqgafylfidfsayygseaegfglindssslalyfldkf
    qvamvpgdafgddscirisyatsldvlqaavekirkalepl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5wmhD (D:)
    masqssvavissaaargesfpdskkpigsvrfqqplrlsfsycksgnmssricamakpnd
    aetlsssvdmslsprvqslkpsktmvitdlaatlvqsgvpvirlaagepdfdtpkvvaea
    ginairegftrytlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavc
    spgdeviipapywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcs
    psnptgsvypkslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertlt
    vngfskafamtgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkagget
    vaemvkayrerrdflvkslgdikgvkisepqgafylfidfsayygseaegfglindsssl
    alyfldkfqvamvpgdafgddscirisyatsldvlqaavekirkaleplratvsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wmhD (D:)
    mslsprvqslkpsktmvitdlaatlvqsgvpvirlaagepdfdtpkvvaeaginairegf
    trytlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavcspgdeviip
    apywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcspsnptgsvy
    pkslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertltvngfskafa
    mtgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkaggetvaemvkayr
    errdflvkslgdikgvkisepqgafylfidfsayygseaegfglindssslalyfldkfq
    vamvpgdafgddscirisyatsldvlqaavekirkalepl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5wmhE (E:)
    masqssvavissaaargesfpdskkpigsvrfqqplrlsfsycksgnmssricamakpnd
    aetlsssvdmslsprvqslkpsktmvitdlaatlvqsgvpvirlaagepdfdtpkvvaea
    ginairegftrytlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavc
    spgdeviipapywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcs
    psnptgsvypkslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertlt
    vngfskafamtgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkagget
    vaemvkayrerrdflvkslgdikgvkisepqgafylfidfsayygseaegfglindsssl
    alyfldkfqvamvpgdafgddscirisyatsldvlqaavekirkaleplratvsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wmhE (E:)
    slsprvqslkpsktmvitdlaatlvqsgvpvirlaagepdfdtpkvvaeaginairegft
    rytlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavcspgdeviipa
    pywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcspsnptgsvyp
    kslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertltvngfskafam
    tgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkaggetvaemvkayre
    rrdflvkslgdikgvkisepqgafylfidfsayygseaegfglindssslalyfldkfqv
    amvpgdafgddscirisyatsldvlqaavekirkalepl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5wmhF (F:)
    masqssvavissaaargesfpdskkpigsvrfqqplrlsfsycksgnmssricamakpnd
    aetlsssvdmslsprvqslkpsktmvitdlaatlvqsgvpvirlaagepdfdtpkvvaea
    ginairegftrytlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavc
    spgdeviipapywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcs
    psnptgsvypkslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertlt
    vngfskafamtgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkagget
    vaemvkayrerrdflvkslgdikgvkisepqgafylfidfsayygseaegfglindsssl
    alyfldkfqvamvpgdafgddscirisyatsldvlqaavekirkaleplratvsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wmhF (F:)
    dmslsprvqsltmvitdlaatlvqsgvpvirlaagepdfdtpkvvaeaginairegftry
    tlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavcspgdeviipapy
    wvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcspsnptgsvypks
    lleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertltvngfskafamtg
    wrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkaggetvaemvkayrerr
    dflvkslgdikgvkisepqgafylfidfsayygseaegfglindssslalyfldkfqvam
    vpgdafgddscirisyatsldvlqaavekirkalepl