PDB entry 5wmg

View 5wmg on RCSB PDB site
Description: N-terminal bromodomain of BRD4 in complex with OTX-015
Class: transcription/transcription inhibitor
Keywords: bromodomain, BRD4, transcription, PLX51107, transcription-transcription inhibitor complex
Deposited on 2017-07-28, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 1.19 Å
R-factor: N/A
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD4, HUNK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60885 (2-126)
      • expression tag (0-1)
      • engineered mutation (54)
    Domains in SCOPe 2.07: d5wmga1, d5wmga2
  • Heterogens: EDO, 6JF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5wmgA (A:)
    gmnppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpayykii
    ktpmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqki
    nelptee