PDB entry 5wmf

View 5wmf on RCSB PDB site
Description: Crystal structure of the Hexameric Ring of Epstein-Barr Virus Nuclear Antigen-1, EBNA1
Class: viral protein
Keywords: EBNA1, DNA binding protein, Epstein-Barr Virus, viral protein
Deposited on 2017-07-28, released 2017-08-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epstein-Barr nuclear antigen 1
    Species: Epstein-Barr virus [TaxId:10377]
    Gene: EBNA1, BKRF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5wmfa_
  • Chain 'B':
    Compound: Epstein-Barr nuclear antigen 1
    Species: Epstein-Barr virus [TaxId:10377]
    Gene: EBNA1, BKRF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5wmfb_
  • Chain 'C':
    Compound: Epstein-Barr nuclear antigen 1
    Species: Epstein-Barr virus [TaxId:10377]
    Gene: EBNA1, BKRF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5wmfc_
  • Chain 'D':
    Compound: Epstein-Barr nuclear antigen 1
    Species: Epstein-Barr virus [TaxId:10377]
    Gene: EBNA1, BKRF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5wmfd_
  • Chain 'E':
    Compound: Epstein-Barr nuclear antigen 1
    Species: Epstein-Barr virus [TaxId:10377]
    Gene: EBNA1, BKRF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5wmfe_
  • Chain 'F':
    Compound: Epstein-Barr nuclear antigen 1
    Species: Epstein-Barr virus [TaxId:10377]
    Gene: EBNA1, BKRF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5wmff_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wmfA (A:)
    gshmgqggsnpkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgta
    laipqcrltplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmt
    kpaptcnirvtvcsfddgvdlppwfppmvegaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wmfA (A:)
    npkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtalaipqcrlt
    plsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtkpaptcnir
    vtvcsfddgvdlppwfp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wmfB (B:)
    gshmgqggsnpkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgta
    laipqcrltplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmt
    kpaptcnirvtvcsfddgvdlppwfppmvegaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wmfB (B:)
    npkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtalaipqcrlt
    plsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtkpaptcnir
    vtvcsfddgvdlppwfp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5wmfC (C:)
    gshmgqggsnpkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgta
    laipqcrltplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmt
    kpaptcnirvtvcsfddgvdlppwfppmvegaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wmfC (C:)
    pkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtalaipqcrltp
    lsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtkpaptcnirv
    tvcsfddgvdlppwfppm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5wmfD (D:)
    gshmgqggsnpkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgta
    laipqcrltplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmt
    kpaptcnirvtvcsfddgvdlppwfppmvegaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wmfD (D:)
    npkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtalaipqcrlt
    plsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtkpaptcnir
    vtvcsfddgvdlppwfp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5wmfE (E:)
    gshmgqggsnpkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgta
    laipqcrltplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmt
    kpaptcnirvtvcsfddgvdlppwfppmvegaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wmfE (E:)
    kfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtalaipqcrltpl
    srlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtkpaptcnirvt
    vcsfddgvdlppwfp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5wmfF (F:)
    gshmgqggsnpkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgta
    laipqcrltplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmt
    kpaptcnirvtvcsfddgvdlppwfppmvegaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wmfF (F:)
    snpkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtalaipqcrl
    tplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtkpaptcni
    rvtvcsfddgvdlppwfppm