PDB entry 5wm3

View 5wm3 on RCSB PDB site
Description: Crystal Structure of CahJ in Complex with Salicyl Adenylate
Class: ligase
Keywords: Ligase, Adenylation Domain, Peptide Synthetase.
Deposited on 2017-07-28, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Salicylate-AMP ligase
    Species: Streptomyces gandocaensis [TaxId:1649596]
    Gene: cahJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A140DJY3 (20-End)
      • expression tag (18-19)
    Domains in SCOPe 2.07: d5wm3a1, d5wm3a2
  • Heterogens: B5V, MG, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wm3A (A:)
    mgsshhhhhhssglvprgshmldgwvpwpesfarryraagywegrpldrllreraaadpd
    rialvdaagdrwtyaeldrhadrqaaglrrlgigagdrvvvqlpntdafvvlffallrag
    avpvltlpahreseivhvaetagatayvipdvldgfdhralaraarkavpsiehvlvage
    aaeftaladvdaapvplaepdpgdvallllsggttgkpkliprthddytynvrasaevcg
    fdsdtvylvvlptahnfalacpgllgtlmvggtvvlaptpspedafelierekvtatavv
    ppvallwldavewedadlsslrllqvggsklgaepaarvrpalgctlqqvfgmaegllny
    trlddpsdlviqtqgrplspddeirvvdedgrdvapgetgelltrgpytlrgyyrapehn
    artfsddgfyrtgdlvrvlpsghlvvegrakdqinrggdkisaeelenhimahpgvhdaa
    vvgmpdatmgertcaclvpragrsapaqrelaafltdrgvaayklpdrvevmdafprtsv
    gktdkkelgrriagqlrtedggvh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wm3A (A:)
    shmldgwvpwpesfarryraagywegrpldrllreraaadpdrialvdaagdrwtyaeld
    rhadrqaaglrrlgigagdrvvvqlpntdafvvlffallragavpvltlpahreseivhv
    aetagatayvipdvldgfdhralaraarkavpsiehvlvageaaeftaladvdaapvpla
    epdpgdvallllsggttgkpkliprthddytynvrasaevcgfdsdtvylvvlptahnfa
    lacpgllgtlmvggtvvlaptpspedafelierekvtatavvppvallwldavewedadl
    sslrllqvggsklgaepaarvrpalgctlqqvfgmaegllnytrlddpsdlviqtqgrpl
    spddeirvvdedgrdvapgetgelltrgpytlrgyyrapehnartfsddgfyrtgdlvrv
    lpsghlvvegrakdqinrggdkisaeelenhimahpgvhdaavvgmpdatmgertcaclv
    pragrsapaqrelaafltdrgvaayklpdrvevmdafprtsvgktdkkelgrriagq