PDB entry 5wm0

View 5wm0 on RCSB PDB site
Description: Crystal structure of apo wild type peptidylglycine alpha-hydroxylating monooxygenase (PHM) soaked with peptide (peptide not observed)
Class: oxidoreductase
Keywords: peptidylglycine monooxygenase, peptidylglycine 2-hydroxylase, phm, metal binding protein, oxidoreductase
Deposited on 2017-07-28, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-glycine alpha-amidating monooxygenase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PAM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wm0a1, d5wm0a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wm0A (A:)
    magrarsgllllllgllalqssclafrsplsvfkrfkettrsfsneclgtigpvtpldas
    dfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprasmdtvhhmllfgcnmpsst
    gsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgskyfvlqvhygdisafr
    dnhkdcsgvsvhltrvpqpliagmylmmsvdtvippgekvvnadiscqykmypmhvfayr
    vhthhlgkvvsgyrvrngqwtligrqnpqlpqafypvehpvdvtfgdilaarcvftgegr
    teathiggtssdemcnlyimyymeakyalsfmtctknvapdmfrtipaeanipipvkpdm
    vmmhghhkeaenkeksalmqqpkqgeeevleqgdfysllskllgeredvhvhkynptekt
    esgsdlvaeianvvqkkdlgrsdaregaeheewgnailvrdrihrfhqlestlrpaesra
    fsfqqpgegpwepepsgdfhveeeldwpgvyllpgqvsgvaldsknnlvifhrgdhvwdg
    nsfdskfvyqqrglgpieedtilvidpnnaeilqssgknlfylphglsidtdgnywvtdv
    alhqvfkldphskegpllilgrsmqpgsdqnhfcqptdvavepstgavfvsdgycnsriv
    qfspsgkfvtqwgeessgssprpgqfsvphslalvphldqlcvadrengriqcfktdtke
    fvreikhasfgrnvfaisyipgflfavngkpyfgdqepvqgfvmnfssgeiidvfkpvrk
    hfdmphdivasedgtvyigdahtntvwkftltekmehrsvkkagievqeikeaeavvepk
    venkptsselqkmqekqklstepgsgvsvvlittllvipvlvllaivmfirwkksrafgd
    hdrklesssgrvlgrfrgkgsgglnlgnffasrkgysrkgfdrvstegsdqekdeddgte
    seeeysaplpkpapss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wm0A (A:)
    eclgtigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprasmdt
    vhhmllfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgsk
    yfvlqvhygdisafrdnhkdcsgvsvhltrvpqpliagmylmmsvdtvippgekvvnadi
    scqykmypmhvfayrvhthhlgkvvsgyrvrngqwtligrqnpqlpqafypvehpvdvtf
    gdilaarcvftgegrteathigtssdemcnlyimyymeakyalsfmtctknvapdmfrti
    paeanipip