PDB entry 5wl2

View 5wl2 on RCSB PDB site
Description: VH1-69 germline antibody with CDR H3 sequence of CR9114
Class: antiviral protein
Keywords: VH1-69 germline antibody, ANTIVIRAL PROTEIN
Deposited on 2017-07-25, released 2018-08-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heavy chain of VH1-69 germline antibody with CDR H3 sequence of CR9114
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WL2 (0-End)
  • Chain 'B':
    Compound: Germline-reverted light chain of CR9114
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WL2
    Domains in SCOPe 2.08: d5wl2b1, d5wl2b2
  • Chain 'H':
    Compound: Heavy chain of VH1-69 germline antibody with CDR H3 sequence of CR9114
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WL2 (0-End)
  • Chain 'L':
    Compound: Germline-reverted light chain of CR9114
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WL2
    Domains in SCOPe 2.08: d5wl2l1, d5wl2l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wl2B (B:)
    qsvltqppsvseaprqrvtiscsgsssnignnavnwyqqlpgkapklliyyddllpsgvs
    drfsgsksgtsaslaisglqsedeadyycaawddslngavfgggtqltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wl2B (B:)
    vltqppsvseaprqrvtiscsgsssnignnavnwyqqlpgkapklliyyddllpsgvsdr
    fsgsksgtsaslaisglqsedeadyycaawddslngavfgggtqltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5wl2L (L:)
    qsvltqppsvseaprqrvtiscsgsssnignnavnwyqqlpgkapklliyyddllpsgvs
    drfsgsksgtsaslaisglqsedeadyycaawddslngavfgggtqltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wl2L (L:)
    vltqppsvseaprqrvtiscsgsssnignnavnwyqqlpgkapklliyyddllpsgvsdr
    fsgsksgtsaslaisglqsedeadyycaawddslngavfgggtqltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvapt