PDB entry 5wkz

View 5wkz on RCSB PDB site
Description: VH1-69 germline antibody predicted from CR6261
Class: immune system
Keywords: VH1-69 germline, CR6261, IMMUNE SYSTEM
Deposited on 2017-07-25, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Immunoglobulin heavy variable 1-69D,IgG H chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHV1-69D
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Lambda-chain (AA -20 to 215)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2NUT2
      • insertion (98)
      • conflict (99)
    Domains in SCOPe 2.07: d5wkzl1, d5wkzl2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5wkzL (L:)
    qsvltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydnnkrpsgip
    drfsgsksgtsatlgitglqtgdeadyycgtwdsslsayvvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wkzL (L:)
    vltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydnnkrpsgipdr
    fsgsksgtsatlgitglqtgdeadyycgtwdsslsayvvfgggtkltvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvapt