PDB entry 5wkw

View 5wkw on RCSB PDB site
Description: Crystal structure of apo wild type peptidylglycine alpha-hydroxylating monooxygenase (PHM)
Class: oxidoreductase
Keywords: peptidylglycine monooxygenase, peptidylglycine 2-hydroxylase, phm, oxidoreductase
Deposited on 2017-07-25, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-glycine alpha-amidating monooxygenase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PAM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wkwa1, d5wkwa2
  • Heterogens: PEG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5wkwA (A:)
    neclgtigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprasmd
    tvhhmllfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgs
    kyfvlqvhygdisafrdnhkdcsgvsvhltrvpqpliagmylmmsvdtvippgekvvnad
    iscqykmypmhvfayrvhthhlgkvvsgyrvrngqwtligrqnpqlpqafypvehpvdvt
    fgdilaarcvftgegrteathiggtssdemcnlyimyymeakyalsfmtctknvapdmfr
    tipaeanipipv