PDB entry 5wkk

View 5wkk on RCSB PDB site
Description: 1.55 A resolution structure of MERS 3CL protease in complex with inhibitor GC813
Class: hydrolase/hydrolase inhibitor
Keywords: PROTEASE, protease Inhhibitors, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2017-07-25, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Orf1a protein
    Species: Middle East respiratory syndrome-related coronavirus [TaxId:1335626]
    Gene: ORF1a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wkka1, d5wkka2
  • Heterogens: PG4, MG, AW4, B3G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wkkA (A:)
    mhhhhhhsglvkmshpsgdveacmvqvtcgsmtlnglwldntvwcprhvmcpadqlsdpn
    ydallismtnhsfsvqkhigapanlrvvghamqgtllkltvdvanpstpaytfttvkpga
    afsvlacyngrptgtftvvmrpnytikgsflcgscgsvgytkegsvinfcymhqmelang
    thtgsafdgtmygafmdkqvhqvqltdkycsvnvvawlyaailngcawfvkpnrtsvvsf
    newalanqftefvgtqsvdmlavktgvaieqllyaiqqlytgfqgkqilgstmledeftp
    edvnmqimgvvmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wkkA (A:)
    hhsglvkmshpsgdveacmvqvtcgmtlnglwldntvwcprhvmcpadqlsdpnydalli
    smtnhsfsvqkhanlrvvghamqgtllkltvdvanpstpaytfttvkpgaafsvlacyng
    rptgtftvvmrpnytikgsflcgscgsvgytkegsvinfcymhqmelangthtgsafdgt
    mygafmdkqvhqvqltdkycsvnvvawlyaailngcawfvkpnrtsvvsfnewalanqft
    efvgtqsvdmlavktgvaieqllyaiqqlytgfqgkqilgstmledeftpedvnmqimgv
    v