PDB entry 5wk7

View 5wk7 on RCSB PDB site
Description: P450cam mutant R186A
Class: oxidoreductase
Keywords: salt bridge interaction, proton coupled electron transfer, OXIDOREDUCTASE
Deposited on 2017-07-24, released 2017-09-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Camphor 5-monooxygenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-414)
      • engineered mutation (186)
      • engineered mutation (334)
    Domains in SCOPe 2.07: d5wk7a_
  • Heterogens: HEM, CAH, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wk7A (A:)
    mttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcn
    gghwiatrgqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvv
    gmpvvdklenriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlky
    ltdqmtapdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeak
    rmcglllvggldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgr
    iltsdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclg
    qhlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wk7A (A:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtapdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
    ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav