PDB entry 5wjj

View 5wjj on RCSB PDB site
Description: Structure-based Design, Synthesis, and Biological Evaluation of Imidazo[1,2-b]pyridazine-based p38 MAP Kinase Inhibitors
Class: Transferase/Transferase Inhibitor
Keywords: Transferase-Transferase Inhibitor complex
Deposited on 2017-07-23, released 2018-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-14, with a file datestamp of 2018-02-09.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2, SAPK2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16539
      • conflict (123)
      • conflict (166)
    Domains in SCOPe 2.07: d5wjja_
  • Heterogens: AQY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wjjA (A:)
    gamgsmsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkkl
    srpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnn
    ivksqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedselkildfglarht
    ddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlkli
    lrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdk
    ritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldq
    eemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wjjA (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivksqkltd
    dhvqfliyqilrglkyihsadiihrdlkpsnlavnedselkildfglarhtddatrwyra
    peimlnwhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkis
    sesarnyiqqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdp
    ddepvadpydqsfesrdllidewksltydevisfvppp