PDB entry 5wjc

View 5wjc on RCSB PDB site
Description: Crystal structure of Schizosaccharomyces pombe Mis16 in complex with Eic1
Class: protein binding
Keywords: Fission yeast chaperone for histone H4, Subcomponent of Mis18 complex, Eic1 binding, WD-40 repeats domain, PROTEIN BINDING
Deposited on 2017-07-21, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinetochore protein Mis16
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Gene: mis16, hat2, SPCC1672.10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wjca_
  • Chain 'B':
    Compound: Eic1 protein
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Gene: SPBC27B12.02, SPBC30B4.10
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wjcA (A:)
    mseevvqdaplennelnaeidlqktiqeeyklwkqnvpflydlvithalewpsltiqwlp
    dkktipgtdysiqrlilgthtsgndqnylqiasvqlpnfdedtteftpstirraqatgsy
    tieisqkiphdgdvnrarympqkpeiiatmgeggnayifdttchdalttgealpqavlkg
    htaegfglcwnpnlpgnlatgaedqviclwdvqtqsftssetkvispiakyhrhtdivnd
    vqfhpqheallasvsddctlqihdtrlnpeeeapkviqahskainavainpfndyllata
    sadktvalwdlrnpyqrlhtleghedevyglewsphdepilassstdrrvciwdlekige
    eqtpedaedgspellfmhgghtnrisefswcpnerwvvgsladdnilqiwspsrviwgrd
    hvqvsprdle
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wjcA (A:)
    elnaeidlqktiqeeyklwkqnvpflydlvithalewpsltiqwlpdkktipgtdysiqr
    lilgthtsgndqnylqiasvqlpnsytieisqkiphdgdvnrarympqkpeiiatmgegg
    nayifdttchdalttgealpqavlkghtaegfglcwnpnlpgnlatgaedqviclwdvqt
    qsftssetkvispiakyhrhtdivndvqfhpqheallasvsddctlqihdtrlnpeeeap
    kviqahskainavainpfndyllatasadktvalwdlrnpyqrlhtleghedevyglews
    phdepilassstdrrvciwdlekigeeqtpedaedgspellfmhgghtnrisefswcpne
    rwvvgsladdnilqiwspsrviwg
    

  • Chain 'B':
    No sequence available.