PDB entry 5wid

View 5wid on RCSB PDB site
Description: Structure of a flavodoxin from the domain Archaea
Class: flavoprotein
Keywords: flavodoxin, Methanosarcina acetivorans, FLAVOPROTEIN
Deposited on 2017-07-19, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Methanosarcina acetivorans C2A [TaxId:188937]
    Gene: MA_1799
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wida_
  • Chain 'B':
    Compound: flavodoxin
    Species: Methanosarcina acetivorans C2A [TaxId:188937]
    Gene: MA_1799
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5widb_
  • Chain 'C':
    Compound: flavodoxin
    Species: Methanosarcina acetivorans C2A [TaxId:188937]
    Gene: MA_1799
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5widc_
  • Heterogens: FMN, ACT, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5widA (A:)
    mkaivvylstsgntkamaeaigngiesknvdvqvisfydvkldelkeaeaiavgsstfyy
    kmllpmekfmdetlvasnpqgkigaafgsygwsgeapiliaekmremgmtvmdpvlrilh
    kptdkdlqeckrlgidiaekvkhkgtkae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5widA (A:)
    mkaivvylstsgntkamaeaigngiesknvdvqvisfydvkldelkeaeaiavgsstfyy
    kmllpmekfmdetlvasnpqgkigaafgsygwsgeapiliaekmremgmtvmdpvlrilh
    kptdkdlqeckrlgidiaekvkhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5widB (B:)
    mkaivvylstsgntkamaeaigngiesknvdvqvisfydvkldelkeaeaiavgsstfyy
    kmllpmekfmdetlvasnpqgkigaafgsygwsgeapiliaekmremgmtvmdpvlrilh
    kptdkdlqeckrlgidiaekvkhkgtkae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5widB (B:)
    mkaivvylstsgntkamaeaigngiesknvdvqvisfydvkldelkeaeaiavgsstfyy
    kmllpmekfmdetlvasnpqgkigaafgsygwsgeapiliaekmremgmtvmdpvlrilh
    kptdkdlqeckrlgidiaekvkh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5widC (C:)
    mkaivvylstsgntkamaeaigngiesknvdvqvisfydvkldelkeaeaiavgsstfyy
    kmllpmekfmdetlvasnpqgkigaafgsygwsgeapiliaekmremgmtvmdpvlrilh
    kptdkdlqeckrlgidiaekvkhkgtkae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5widC (C:)
    mkaivvylstsgntkamaeaigngiesknvdvqvisfydvkldelkeaeaiavgsstfyy
    kmllpmekfmdetlvasnpqgkigaafgsygwsgeapiliaekmremgmtvmdpvlrilh
    kptdkdlqeckrlgidiaekvkhk