PDB entry 5wi6

View 5wi6 on RCSB PDB site
Description: Human beta-1 tryptase mutant Ile99Cys
Class: hydrolase/hydrolase inhibitor
Keywords: disulfide mutation, HYDROLASE, hydrolase-hydrolase inhibitor complex
Deposited on 2017-07-18, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptase alpha/beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TPSAB1, TPS1, TPS2, TPSB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15661 (0-End)
      • engineered mutation (87)
    Domains in SCOPe 2.07: d5wi6a_
  • Chain 'B':
    Compound: tryptase alpha/beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TPSAB1, TPS1, TPS2, TPSB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15661 (0-End)
      • engineered mutation (87)
    Domains in SCOPe 2.07: d5wi6b_
  • Chain 'C':
    Compound: tryptase alpha/beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TPSAB1, TPS1, TPS2, TPSB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15661 (0-End)
      • engineered mutation (87)
    Domains in SCOPe 2.07: d5wi6c_
  • Chain 'D':
    Compound: tryptase alpha/beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TPSAB1, TPS1, TPS2, TPSB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15661 (0-End)
      • engineered mutation (87)
    Domains in SCOPe 2.07: d5wi6d_
  • Heterogens: SO4, 0GJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wi6A (A:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqcgadialleleepvnvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wi6A (A:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqcgadialleleepvnvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wi6B (B:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqcgadialleleepvnvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wi6B (B:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqcgadialleleepvnvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5wi6C (C:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqcgadialleleepvnvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wi6C (C:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqcgadialleleepvnvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5wi6D (D:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqcgadialleleepvnvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wi6D (D:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqcgadialleleepvnvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpk