PDB entry 5whi

View 5whi on RCSB PDB site
Description: Crystal Structure of Bcl-2-related protein A1
Class: apoptosis
Keywords: apoptosis
Deposited on 2017-07-17, released 2018-01-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bcl-2-related protein a1
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL2A1, BCL2L5, BFL1, GRS, HBPA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16548 (Start-160)
      • engineered mutation (13)
      • engineered mutation (28)
    Domains in SCOPe 2.08: d5whia_
  • Heterogens: CAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5whiA (A:)
    mghhhhhhshmtdsefgyiyrlaqdylqsvlqipqpgsgpsktsrvlqnvafsvqkevek
    nlkscldnvnvvsvdtartlfnqvmekefedgiinwgrivtifafegilikkllrqqiap
    dvdtykeisyfvaefimnntgewirqnggwengfvkkfepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5whiA (A:)
    sefgyiyrlaqdylqsvlqipqsgpsktsrvlqnvafsvqkeveknlkscldnvnvvsvd
    tartlfnqvmekefedgiinwgrivtifafegilikkllrqqiapdvdtykeisyfvaef
    imnntgewirqnggwengfvkkfepk