PDB entry 5wgb

View 5wgb on RCSB PDB site
Description: Crystal Structure of the Human mitochondrial Cysteine Desulfurase in complex with ISD11 and E. coli ACP1 protein at 2.75A
Class: transferase
Keywords: Human mitochondrial cysteine desulfurse LYR Motif containing protein 4 Acyl Carrier Protein 1 (E.coli), TRANSFERASE
Deposited on 2017-07-13, released 2017-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine desulfurase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: NFS1, NIFS, HUSSY-08
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: LYR motif-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: LYRM4, C6orf149, ISD11, CGI-203
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HD34
      • conflict (10)
  • Chain 'C':
    Compound: Acyl carrier protein
    Species: Escherichia coli O45:K1 (strain S88 / ExPEC) [TaxId:585035]
    Gene: acpP, ECS88_1108
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wgbc_
  • Heterogens: PLP, 8Q1

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5wgbC (C:)
    stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
    kittvqaaidyinghqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wgbC (C:)
    ieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeaeki
    ttvqaaidyin