PDB entry 5wg8

View 5wg8 on RCSB PDB site
Description: Structure of PP5C with LB-100; 7-oxabicyclo[2.2.1]heptane-2,3-dicarbonyl moiety modeled in the density
Class: HYDROLASE/HYDROLASE inhibitor
Keywords: Hydrolase Inhibitor, HYDROLASE, HYDROLASE-HYDROLASE inhibitor complex
Deposited on 2017-07-13, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein phosphatase 5
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP5C, PPP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wg8a_
  • Heterogens: LB1, MN, MPD, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wg8A (A:)
    gasmtiedeysgpkledgkvtisfmkelmqwykdqkklhrkcayqilvqvkevlsklstl
    vettlketekitvcgdthgqfydllnifelnglpsetnpyifngdfvdrgsfsveviltl
    fgfkllypdhfhllrgnhetdnmnqiygfegevkakytaqmyelfsevfewlplaqcing
    kvlimhgglfsedgvtlddirkiernrqppdsgpmcdllwsdpqpqngrsiskrgvscqf
    gpdvtkafleennldyiirshevkaegyevahggrcvtvfsapnycdqmgnkasyihlqg
    sdlrpqfhqftavphpnvkpmayantllqlgmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wg8A (A:)
    iedeysgpkledgkvtisfmkelmqwykdqkklhrkcayqilvqvkevlsklstlvettl
    ketekitvcgdthgqfydllnifelnglpsetnpyifngdfvdrgsfsveviltlfgfkl
    lypdhfhllrgnhetdnmnqiygfegevkakytaqmyelfsevfewlplaqcingkvlim
    hgglfsedgvtlddirkiernrqppdsgpmcdllwsdpqpqngrsiskrgvscqfgpdvt
    kafleennldyiirshevkaegyevahggrcvtvfsapnycdqmgnkasyihlqgsdlrp
    qfhqftavphpnvkpmayan