PDB entry 5wez

View 5wez on RCSB PDB site
Description: Structure of the Tir-CesT effector-chaperone complex
Class: chaperone
Keywords: effector, complex, secretion, translocation, CHAPERONE
Deposited on 2017-07-11, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tir chaperone
    Species: Escherichia coli O127:H6 (strain E2348/69 / EPEC) [TaxId:574521]
    Gene: cesT, E2348C_3940
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21244 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d5weza1, d5weza2
  • Chain 'B':
    Compound: Translocated intimin receptor Tir
    Species: Escherichia coli O127:H6 (strain E2348/69 / EPEC) [TaxId:574521]
    Gene: tir, espE, E2348C_3941
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wezA (A:)
    massrsellldrfaekigvgsisfnenrlcsfaideiyyislsdandeymmiygvcgkfp
    tdnpnfaleilnanlwfaenggpylcyesgaqslllalrfplddatpekleneievvvks
    menlylvlhnqgitleneh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wezA (A:)
    assrsellldrfaekigvgsisfnenrlcsfaideiyyislsdandeymmiygvcgkfpt
    dnpnfaleilnanlwfaenggpylcyesgaqslllalrfplddatpekleneievvvksm
    enlylvlhn
    

  • Chain 'B':
    No sequence available.