PDB entry 5weq

View 5weq on RCSB PDB site
Description: The crystal structure of a MR78 mutant
Class: immune system
Keywords: Marburg Virus, Antibody, IMMUNE SYSTEM
Deposited on 2017-07-10, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MR78 mutant light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WEQ
    Domains in SCOPe 2.07: d5weqa1, d5weqa2
  • Chain 'B':
    Compound: MR78 mutant Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WEQ (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5weqA (A:)
    diqmtqspsslsasvgdrvtitcqasqvisnylnwyqqkpgkapklliydtsnlktgvps
    rfsgsgsgtdftftisslqpediatyycqqyenlqftfgpgtkvdikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglrspvtksfnrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >5weqA (A:)
    iqmtqspsslsasvgdrvtitcqasqvisnylnwyqqkpgkapklliydtsnlktgvpsr
    fsgsgsgtdftftisslqpediatyycqqyenlqftfgpgtkvdikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglrspvtksfnrg
    

  • Chain 'B':
    No sequence available.