PDB entry 5weg

View 5weg on RCSB PDB site
Description: Crystal Structure of UDP-glucose pyrophosphorylase from Sugarcane
Class: transferase
Keywords: transferase
Deposited on 2017-07-10, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UTP--glucose-1-phosphate uridylyltransferase
    Species: Saccharum hybrid cultivar SP80-3280 [TaxId:193079]
    Gene: Ugpase-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wega1, d5wega2
  • Chain 'B':
    Compound: UTP--glucose-1-phosphate uridylyltransferase
    Species: Saccharum hybrid cultivar SP80-3280 [TaxId:193079]
    Gene: Ugpase-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wegb1, d5wegb2
  • Heterogens: EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wegA (A:)
    maaaaaaevsvdekldklraevakldqisenekagfislvsrylsgeaeqiewskiqtpt
    devvvpydtlasppedleetkklldklvvlklngglgttmgctgpksvievrngftfldl
    iviqieslnkkygcsvplllmnsfnthddtqkivekysnsnieihtfnqsqyprivtedf
    lplpskgksgkdgwyppghgdvfpslnnsgkldillaqgkeyvfiansdnlgaivdikil
    nhlinnqneycmevtpktladvkggtlisyegrvqlleiaqvpdehvnefksiekfkifn
    tnnlwvnlkaikrlveaealkmeiipnpkevdgvkvlqletaagaairffdkaiginvpr
    srflpvkatsdlllvqsdlytlvdgfvirnparanpanpsielgpefkkvanflarfksi
    psiveldslkvsgdvwfgsgitlkgkvtitaksgvkleipdgavlenkdvngpedl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wegA (A:)
    ekldklraevakldqisenekagfislvsrylsqiewskiqtptdevvvpydtlasdlee
    tkklldklvvlklngglgttmgctgpksvievrngftfldliviqieslnkkygcsvpll
    lmnsfnthddtqkivekysnsnieihtfnqsqyprivtedflplpskgksgkdgwyppgh
    gdvfpslnnsgkldillaqgkeyvfiansdnlgaivdikilnhlinnqneycmevtpktl
    adggtlisyegrvqlleiaqvpdehvnefksiekfkifntnnlwvnlkaikrlveaealk
    meiipnpkevdgvkvlqletaagaairffdkaiginvprsrflpvkatsdlllvqsdlyt
    lvdgfvirnparanpanpsielgpefkkvanflarfksipsiveldslkvsgdvwfgsgi
    tlkgkvtitaksgvkleipdgavlenkdvngpedl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wegB (B:)
    maaaaaaevsvdekldklraevakldqisenekagfislvsrylsgeaeqiewskiqtpt
    devvvpydtlasppedleetkklldklvvlklngglgttmgctgpksvievrngftfldl
    iviqieslnkkygcsvplllmnsfnthddtqkivekysnsnieihtfnqsqyprivtedf
    lplpskgksgkdgwyppghgdvfpslnnsgkldillaqgkeyvfiansdnlgaivdikil
    nhlinnqneycmevtpktladvkggtlisyegrvqlleiaqvpdehvnefksiekfkifn
    tnnlwvnlkaikrlveaealkmeiipnpkevdgvkvlqletaagaairffdkaiginvpr
    srflpvkatsdlllvqsdlytlvdgfvirnparanpanpsielgpefkkvanflarfksi
    psiveldslkvsgdvwfgsgitlkgkvtitaksgvkleipdgavlenkdvngpedl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wegB (B:)
    ekldklraevakldqisenekagfislvsrylsgiewskiqtptdevvvpydtladleet
    kklldklvvlklngglgttmgctgpksvievrngftfldliviqieslnkkygcsvplll
    mnsfnthddtqkivekysnsnieihtfnqsqyprivtedflplpsgkdgwyppghgdvfp
    slnnsgkldillaqgkeyvfiansdnlgaivdikilnhlinnqneycmevtpktladvkg
    gtlisyegrvqlleiaqvpdehvnefksiekfkifntnnlwvnlkaikrlveaealkmei
    ipnpkevdgvkvlqletaagaairffdkaiginvprsrflpvkatsdlllvqsdlytlvd
    gfvirnparanpanpsielgpefkkvanflarfksipsiveldslkvsgdvwfgsgitlk
    gkvtitaksgvkleipdgavlenkdvngpedl