PDB entry 5we9
View 5we9 on RCSB PDB site
Description: Crystal structure of the influenza virus PA endonuclease in complex with inhibitor 7b (SRI-29731)
Class: hydrolase/hydrolase inhibitor
Keywords: Virus, Nuclease, Transcription, Cap-snatching, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on
2017-07-07, released
2017-12-27
The last revision prior to the SCOPe 2.08 freeze date was dated
2019-12-11, with a file datestamp of
2019-12-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Polymerase acidic protein
Species: Influenza A virus [TaxId:641501]
Gene: PA
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d5we9a1, d5we9a2 - Heterogens: GY7, MN, MG, EDO, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>5we9A (A:)
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
egrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyylekankik
sekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqseraaa
elalvpr
Sequence, based on observed residues (ATOM records): (download)
>5we9A (A:)
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
egrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyylekankik
sekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqsera